Loading...
Statistics
Advertisement

while i'm ghana – explore & innovate
www.whileimghana.com/
explore & innovate

Whileimghana.com

Advertisement
Whileimghana.com is hosted in United States / San Francisco . Whileimghana.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Gravatar, Html, Number of used javascripts: 6. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Whileimghana.com

Technology

Number of occurences: 9
  • CSS
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 6
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Whileimghana.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 315220606725537856826659676906445890616412
    • validFrom: 160815185200Z
    • validTo: 161113185200Z
    • validFrom_time_t: 1471287120
    • validTo_time_t: 1479063120
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: F9:7E:F4:92:98:3E:94:E6:31:A1:FE:45:62:B2:3A:65:28:45:B5:65
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:whileifelse.com, DNS:whileimghana.com, DNS:whileimwaiting.org, DNS:whileimwaitingblog.com, DNS:whileinaustralia.com, DNS:whileinheels.com, DNS:whileinswitzerland.com, DNS:whileiwait.org, DNS:whileiwasreading.com, DNS:whilejacknaps.com, DNS:whilemaandpawsawaypetservices.com, DNS:whilemollynaps.com, DNS:whilemywifeisatwork.com, DNS:whileoutsailing.com, DNS:whilepaper.com, DNS:whilerain.com, DNS:whileriversleeps.com, DNS:whilesilent.com, DNS:whilethecatnaps.com, DNS:whiletoday.com, DNS:whileurwaiting.com, DNS:whilewaitingtoexhale.com, DNS:whilewalkingmydogs.com, DNS:whileweslept.net, DNS:whileweslept.org, DNS:whilewetarry.org, DNS:www.whileimghana.com, DNS:www.whileimwaiting.org, DNS:www.whileimwaitingblog.com, DNS:www.whileinaustralia.com, DNS:www.whileinheels.com, DNS:www.whileinswitzerland.com, DNS:www.whileiwait.org, DNS:www.whileiwasreading.com, DNS:www.whilejacknaps.com, DNS:www.whilemaandpawsawaypetservices.com, DNS:www.whilemollynaps.com, DNS:www.whilemywifeisatwork.com, DNS:www.whileoutsailing.com, DNS:www.whilepaper.com, DNS:www.whilerain.com, DNS:www.whileriversleeps.com, DNS:www.whilesilent.com, DNS:www.whilethecatnaps.com, DNS:www.whiletoday.com, DNS:www.whileurwaiting.com, DNS:www.whilewaitingtoexhale.com, DNS:www.whilewalkingmydogs.com, DNS:www.whileweslept.net, DNS:www.whileweslept.org
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Whileimghana.com

Number of occurences: 11
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #f2f2f2
  • Name: application-name
    Content: while i'm ghana
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: explore & innovate
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: while i'm ghana on WordPress.com
  • Name: description
    Content: explore & innovate

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns2.wordpress.com
  • ns1.wordpress.com
  • ns3.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Thu, 15 Sep 2016 12:44:15 GMT Content-Type: text/html Content-Length: 178 Location: https://www.whileimghana.com/ X-ac: 3.bur _bur X-Cache: MISS from s_ub9 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 301 Moved Permanently Server: nginx Date: Thu, 15 Sep 2016 12:44:16 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Strict-Transport-Security: max-age=86400 Location: https://whileimghana.com/ X-ac: 3.bur _bur HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Thu, 15 Sep 2016 12:44:17 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.bur _bur

DNS

host: whileimghana.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: whileimghana.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: whileimghana.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: whileimghana.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: whileimghana.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: whileimghana.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hileimghana.com, www.w hileimghana.com, www. hileimghana.com, www.wchileimghana.com, www.chileimghana.com, www.whileimghana.com, www.hileimghana.com, www.wdhileimghana.com, www.dhileimghana.com, www.wfhileimghana.com, www.fhileimghana.com, www.wghileimghana.com, www.ghileimghana.com, www.wbhileimghana.com, www.bhileimghana.com, www.wileimghana.com, www.wheileimghana.com, www.weileimghana.com, www.whdileimghana.com, www.wdileimghana.com, www.whcileimghana.com, www.wcileimghana.com, www.whuileimghana.com, www.wuileimghana.com, www.whjileimghana.com, www.wjileimghana.com, www.whileimghana.com, www.wileimghana.com, www.whbileimghana.com, www.wbileimghana.com, www.whgileimghana.com, www.wgileimghana.com, www.whleimghana.com, www.whirleimghana.com, www.whrleimghana.com, www.whifleimghana.com, www.whfleimghana.com, www.whivleimghana.com, www.whvleimghana.com, www.whikleimghana.com, www.whkleimghana.com, www.whi,leimghana.com, www.wh,leimghana.com, www.whibleimghana.com, www.whbleimghana.com, www.whigleimghana.com, www.whgleimghana.com, www.whitleimghana.com, www.whtleimghana.com, www.whiyleimghana.com, www.whyleimghana.com, www.whiuleimghana.com, www.whuleimghana.com, www.whijleimghana.com, www.whjleimghana.com, www.whimleimghana.com, www.whmleimghana.com, www.whinleimghana.com, www.whnleimghana.com, www.whieimghana.com, www.whilueimghana.com, www.whiueimghana.com, www.whil8eimghana.com, www.whi8eimghana.com, www.whil9eimghana.com, www.whi9eimghana.com, www.whiljeimghana.com, www.whijeimghana.com, www.whil0eimghana.com, www.whi0eimghana.com, www.whilmeimghana.com, www.whimeimghana.com, www.whilpeimghana.com, www.whipeimghana.com, www.whiloeimghana.com, www.whioeimghana.com, www.whilimghana.com, www.whileximghana.com, www.whilximghana.com, www.whilesimghana.com, www.whilsimghana.com, www.whilewimghana.com, www.whilwimghana.com, www.whilerimghana.com, www.whilrimghana.com, www.whilefimghana.com, www.whilfimghana.com, www.whilevimghana.com, www.whilvimghana.com, www.whilecimghana.com, www.whilcimghana.com, www.whileqimghana.com, www.whilqimghana.com, www.whileaimghana.com, www.whilaimghana.com, www.whileyimghana.com, www.whilyimghana.com, www.whilemghana.com, www.whileirmghana.com, www.whilermghana.com, www.whileifmghana.com, www.whilefmghana.com, www.whileivmghana.com, www.whilevmghana.com, www.whileikmghana.com, www.whilekmghana.com, www.whilei,mghana.com, www.while,mghana.com, www.whileibmghana.com, www.whilebmghana.com, www.whileigmghana.com, www.whilegmghana.com, www.whileitmghana.com, www.whiletmghana.com, www.whileiymghana.com, www.whileymghana.com, www.whileiumghana.com, www.whileumghana.com, www.whileijmghana.com, www.whilejmghana.com, www.whileimmghana.com, www.whilemmghana.com, www.whileinmghana.com, www.whilenmghana.com, www.whileighana.com, www.whileimpghana.com, www.whileipghana.com, www.whileimoghana.com, www.whileioghana.com, www.whileimighana.com, www.whileiighana.com, www.whileimkghana.com, www.whileikghana.com, www.whileim.ghana.com, www.whilei.ghana.com, www.whileimughana.com, www.whileiughana.com, www.whileimjghana.com, www.whileijghana.com, www.whileimnghana.com, www.whileinghana.com, www.whileim-ghana.com, www.whilei-ghana.com, www.whileimhana.com, www.whileimgshana.com, www.whileimshana.com, www.whileimgxhana.com, www.whileimxhana.com, www.whileimgyhana.com, www.whileimyhana.com, www.whileimghhana.com, www.whileimhhana.com, www.whileimgnhana.com, www.whileimnhana.com, www.whileimgchana.com, www.whileimchana.com, www.whileimgdhana.com, www.whileimdhana.com, www.whileimgehana.com, www.whileimehana.com, www.whileimgrhana.com, www.whileimrhana.com, www.whileimgthana.com, www.whileimthana.com, www.whileimgbhana.com, www.whileimbhana.com, www.whileimgvhana.com, www.whileimvhana.com,

Other websites we recently analyzed

  1. 6xxb.com
    6xxb.com
    China - 45.116.62.60
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 3
  2. Unbenannt-3
    Germany - 217.160.231.95
    Server software: Apache
    Technology: Swf Object
    Number of meta tags: 1
  3. Home
    Scottsdale (United States) - 72.167.191.69
    Server software: DPS/1.0.6
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 2
    Number of meta tags: 2
  4. advanstaffing.com
    Scottsdale (United States) - 184.168.221.57
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  5. getSolusi | Solution to most of your problems
    Introducing Lollipop, a sweet new take on Android.
    Singapore (Singapore) - 45.114.117.32
    Server software: LiteSpeed
    Technology: CSS, Google Font API, Html, SVG
    Number of Javascript: 1
    Number of meta tags: 3
  6. Zahntechnik Grobolsek
    Zahntechnisches Labor Grobolsek, Fellbach, Zahntechnik Stuttgart
    Berlin (Germany) - 81.169.145.145
    Server software: Apache/2.2.31 (Unix)
    Technology: Html
    Number of meta tags: 5
  7. eComptable.com, Expert comptable Melun Fontainebleau et Montereau-Fault-Yonne
    Le cabinet eComptable.com est un cabinet d'expertise comptable et de commissariat aux comptes implanté à Chartrettes.
    France - 178.33.63.200
    Server software: LiteSpeed
    Technology: BootstrapCDN, Maxcdn, OSS CDN, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 3
  8. M.A. BRETAGNE :: Ferienhäuser Vermittlung Ferienhaus Frankreich Urlaub Bretagne
    Individuelle Ferienhäuser in der Bretagne sicher online buchen. Persönliche Beratung: Marie Angoujard - Ferienhäuser Bretagne Ferienhaus - Ferienhausvermittlung M.A. BRETAGNE - Vermittlung von Ferienhäusern in der Bretagne
    Höst (Germany) - 87.230.88.151
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI
    Number of Javascript: 6
    Number of meta tags: 9
  9. Home
    Scottsdale (United States) - 72.167.191.69
    Server software: DPS/1.0.6
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  10. boardroomwatch.com
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1

Check Other Websites